1.67 Rating by CuteStat

It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, stromberger.org is SAFE to browse.

PageSpeed Score
99
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.28.23.33)

Paul Irish

- paulirish.com
310,632 $ 28,620.00


سهامداران پدیده شاندیز و پدیده کیش

- shandizstocks.ir

سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند

30,640 $ 271,440.00

uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras

- uevf.org

Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat

Not Applicable $ 8.95

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

- centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 403 Forbidden
Date: Sat, 18 Apr 2015 21:19:33 GMT
Content-Type: text/html; charset=iso-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Server: cloudflare-nginx
CF-RAY: 1d936898cea70791-MIA
Content-Encoding: gzip

Domain Information

Domain Registrar: DropCatch.com 1498 LLC

Domain Nameserver Information

Host IP Address Country
sid.ns.cloudflare.com 172.64.33.143 United States of America United States of America
ivy.ns.cloudflare.com 108.162.192.120 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
stromberger.org A 299 IP: 104.28.22.33
stromberger.org A 299 IP: 104.28.23.33
stromberger.org NS 21599 Target: sid.ns.cloudflare.com
stromberger.org NS 21599 Target: ivy.ns.cloudflare.com
stromberger.org SOA 21599 MNAME: ivy.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2018077346
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
stromberger.org MX 299 Priority: 10
Target: eltanin.uberspace.de
stromberger.org AAAA 299 IPV6: 2400:cb00:2048:1::681c:1721
stromberger.org AAAA 299 IPV6: 2400:cb00:2048:1::681c:1621

Full WHOIS Lookup

WHOIS LIMIT EXCEEDED - SEE WWW.PIR.ORG/WHOIS FOR DETAILS